I4E1B_HUMAN 2019

Gene Name I4E1B

Description Eukaryotic translation initiation factor 4E type 1B

Links Uniprot

Organism Homo sapiens

Length 242

Loading...
>sp|A6NMX2|I4E1B_HUMAN Eukaryotic translation initiation factor 4E type 1B
MLAVEVSEAEGGIREWEEEEKEEEAAERTPTGEKSPNSPRTLLSLRGKARTGGPMEVKLELHPLQNRWALWFFKNDRSRAWQDNLHLVTKVDTVEDFWALYSHIQLASKLSSGCDYALFKDGIQPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLIGESFEEHSREVCGAVVNIRTKGDKIAVWTREAENQAGVLHVGRVYKERLGLSPKTIIGYQAHADTATKSNSLAKNKFVV
Loading...

No protein with similar profile across the domains were found

Orthologs found in 118 organisms (of 369)

Taxonomic distribution summary

Relationship type Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy