TIM13_HUMAN 2019

Gene Name TIM13

Description Mitochondrial import inner membrane translocase subunit Tim13

Links Uniprot

Organism Homo sapiens

Length 95

Loading...
>sp|Q9Y5L4|TIM13_HUMAN Mitochondrial import inner membrane translocase subunit Tim13
MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM
Loading...

No protein with similar profile across the domains were found

Orthologs found in 122 organisms (of 369)

Taxonomic distribution summary

Relationship type Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy