TIM23_HUMAN 2019

Gene Name TIM23

Description Mitochondrial import inner membrane translocase subunit Tim23

Links Uniprot

Organism Homo sapiens

Length 209

Loading...
>sp|O14925|TIM23_HUMAN Mitochondrial import inner membrane translocase subunit Tim23
MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL
Loading...

No protein with similar profile across the domains were found

Orthologs found in 115 organisms (of 369)

Taxonomic distribution summary

Relationship type Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy